Modomics - A Database of RNA Modifications

Full name:	tRNA (adenine(58)-N(1))-methyltransferase TrmI
Synonym:	Rv2118c, MT2178
GI:	81669088
Orf:
COG:	COG2519
UniProt:	O33253
Structures:	\| 1I9G \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:58 - m1A

Comments:

Homologous to yeast Gcd14 (Trm61) and T. thermophilus TmrI. S-adenosyl-L-methionine is the methyl group donor. Homotetramer.

Protein sequence:

MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG
ARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLM
VYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG

Enzymatic activities:

Reaction	Substrate	Type	Position
A:m1A	tRNA (t)	many/many/prokaryotic cytosol	58

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions.	Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B	BMC Struct Biol	[details]	22168821	-
Mycobacterium tuberculosis Rv2118c codes for a single-component homotetrameric m1A58 tRNA methyltransferase.	Varshney U, Ramesh V, Madabushi A, Gaur R, Subramanya HS, RajBhandary UL	Nucleic Acids Res	[details]	14960715	-
Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.	Gupta A, Kumar PH, Dineshkumar TK, Varshney U, Subramanya HS	J Mol Biol	[details]	11554794	-