Full name: tRNA (guanine-N(7)-)-methyltransferase
Synonym: ytmQ
GI: 14194920
Orf:
COG: COG0220
UniProt: O34522
Structures: | 2FCA |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

AdoMet is the methyl group donor. The activity was tested in vitro on tRNAPhe transctipt.

Protein sequence:

MRMRHKPWADDFLAENADIAISNPADYKGKWNTVFGNDNPIHIEVGTGKGQFISGMAKQNPDINYIGIEL FKSVIVTAVQKVKDSEAQNVKLLNIDADTLTDVFEPGEVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYE EVMGKGGSIHFKTDNRGLFEYSLKSFSEYGLLLTYVSLDLHNSNLEGNIMTEYEEKFSALGQPIYRAEVE WRT

Enzymatic activities:

Reaction Substrate Type Position
G:m7G tRNA (t) Phe/#AA/prokaryotic cytosol 46

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of Bacillus subtilis TrmB, the tRNA (m7G46) methyltransferase. Zegers I, Gigot D, van Vliet F, Tricot C, Aymerich S, Bujnicki JM, Kosinski J, Droogmans L Nucleic Acids Res [details] 16600901 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto