Full name: tRNA pseudouridine(38,39,40) synthase
Synonym: HisT, AsuC, HisT, LeuK
GI: 123176
Orf: b2318
COG: COG0101
UniProt: P07649
Structures: | 1DJ0 | 2NQP | 2NR0 | 2NRE |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:39 - Y
t:40 - Y
t:38 - Y

Comments:

Region specific.

Protein sequence:

MSDQQQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV HFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFY EPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGS LMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Gln/UUG/prokaryotic cytosol 38
U:Y tRNA (t) Gln/CUG/prokaryotic cytosol 38
U:Y tRNA (t) His/GUG/prokaryotic cytosol 38
U:Y tRNA (t) Leu/CAG/prokaryotic cytosol 38
U:Y tRNA (t) Leu/GAG/prokaryotic cytosol 38
U:Y tRNA (t) Asn/GUU/prokaryotic cytosol 39
U:Y tRNA (t) Cys/GCA/prokaryotic cytosol 39
U:Y tRNA (t) Gln/CUG/prokaryotic cytosol 39
U:Y tRNA (t) His/GUG/prokaryotic cytosol 39
U:Y tRNA (t) Ile/CAU/prokaryotic cytosol 39
U:Y tRNA (t) Leu/UAA/prokaryotic cytosol 39
U:Y tRNA (t) Lys/SUU/prokaryotic cytosol 39
U:Y tRNA (t) Met/CAU/prokaryotic cytosol 39
U:Y tRNA (t) Phe/GAA/prokaryotic cytosol 39
U:Y tRNA (t) Tyr/GUA/prokaryotic cytosol 39
U:Y tRNA (t) Arg/UCU/prokaryotic cytosol 40
U:Y tRNA (t) Leu/CAG/prokaryotic cytosol 40
U:Y tRNA (t) Ser/GGA/prokaryotic cytosol 40

Publications:

Title Authors Journal Details PubMed Id DOI
Purification, structure, and properties of Escherichia coli tRNA pseudouridine synthase I. Kammen HO, Marvel CC, Hardy L, Penhoet EE J Biol Chem [details] 3276686 -
Pre-steady-state kinetic analysis of the three Escherichia coli pseudouridine synthases TruB, TruA, and RluA reveals uniformly slow catalysis. Wright JR, Keffer-Wilkes LC, Dobing SR, Kothe U RNA [details] 21998096 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto