Modomics - A Database of RNA Modifications

Full name:	Elongator complex protein 2
Synonym:	TOT2
GI:	1176045
Orf:	G7725
COG:	COG2319
UniProt:	P42935
Structures:	\| \|
Complex:	Elongator complex

Comments:

One of the six protein cofactors required for the synthesis of 5-carboxymethyl group (cm5) on the wobble uridine-34 of a few tRNA. Acetate or acetyl-CoA is the donor of acetyl group, but the detailed mechanism of the reaction is still unknown. The cm5U derivative is the intermediate for further biochemical transformation of U34 derivative to either 5-methoxycarbonylmethyl uridine (mcm5U) catalysed by Trm9/Trm112 or 5-carbamoylmethyluridine (ncm5U) catalysed by a still unknown enzyme. Mutation in Elp (especially Elp3) influences telomeric gene silencing and DNA damage response. The multi-subunit complex El1-6 also interacts with elongating RNA polymerase II (RNAPII) is thought to facilitate transcription through histone acetylation.

Protein sequence:

MVECITPEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTI
QHYSKTIVALSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEG
HEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAAT
ADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGKTGSWRMWATKDNIICDQRLGISGATKDVTDIAWSPSGEYL
LATSLDQTTRLFAPWIYDASGRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILRSFDLPKGVAGMLQKFVGIQFEEKSEMPDSATVPVLGL
SNKAGEDDANEDDEEEEGGNKETPDITDPLSLLECPPMEDQLQRHLLWPEVEKLYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKP
ALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKH
TKAVTAISIHDSMIREKILISVGLENGEIYLYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLSTRIYSLAYE

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae.	Huang B, Lu J, Bystrom AS	RNA	[details]	18755837	-
An early step in wobble uridine tRNA modification requires the Elongator complex.	Huang B, Johansson MJ, Bystrom AS	RNA	[details]	15769872	-
Elongator complex influences telomeric gene silencing and DNA damage response by its role in wobble uridine tRNA modification.	Chen C, Huang B, Eliasson M, Ryden P, Bystrom AS...	PLoS Genet	[details]	21912530	-