Title: | The solution structure of Kti11p |
---|---|
Classification: | METAL BINDING PROTEIN |
Technique: | NMR Solution |
Resolution: | |
Conformers calculated: | 100 |
Conformers submitted: | 20 |
Selection criteria: |
Pdb Files | 1YOP.pdb 1YWS.pdb 4D4O.pdb 4D4P.pdb |
Pdbx/mmCIF Files | 1YOP.cif 1YWS.cif 4D4O.cif 4D4P.cif |
MSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVFDKEDLAEYYEEAGIHPPEPIAAAA
One of the many protein cofactors required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA. The enzyme that catalyzes this reaction is still unknown (2012).
Enter the variants
Position
Original
Variant
Alpha Fold Pdb Files | AF-Q3E840-F1.pdb |
Alpha Fold Pdbx/mmCIF Files | AF-Q3E840-F1.cif |
DSSP Secondary Structures | Q3E840.dssp |
_PubMed_ |