Full name: Diphthamide biosynthesis protein 3
Synonym: DPH3
GI: 21648335
Orf:
COG: COG5216
UniProt: Q3E840
Structures: | 1YOP | 1YWS | 4D4P | 4D4O |
Complex:

Comments:

One of the many protein cofactors required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA. The enzyme that catalyzes this reaction is still unknown (2012).

Protein sequence:

MSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVFDKEDLAEYYEEA GIHPPEPIAAAA

Publications:

Title Authors Journal Details PubMed Id DOI
A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae. Huang B, Lu J, Bystrom AS RNA [details] 18755837 -
An early step in wobble uridine tRNA modification requires the Elongator complex. Huang B, Johansson MJ, Bystrom AS RNA [details] 15769872 -
Structure of the Kti11/Kti13 Heterodimer and Its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2. Glatt S, Zabel R, Vonkova I, Kumar A, Netz DJ, Pierik AJ, Rybin V, Lill R, Gavin A, Balbach J, Breunig KD, Muller CW... Structure [details] 25543256 -
Solution structure of Kti11p from Saccharomyces cerevisiae reveals a novel zinc-binding module. Sun J, Zhang J, Wu F, Xu C, Li S, Zhao W, Wu Z, Wu J, Zhou CZ, Shi Y... Biochemistry [details] 15952786 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto