Full name: tRNA pseudouridine(65) synthase
Synonym: YqcB
GI: 108936020
Orf: yqcB, b2791
COG: COG0564
UniProt: P0AA41
Structures: | |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:65 - Y

Comments:



Protein sequence:

MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGVLLMGLSSEAG RLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDKGPQPAVTHYRGLATVEMPVA TGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSKHGDLRQNRSGAEHFGLQRLMLHASQLSLTH PFTGEPLTIHAGLDDTWMQALSQFGWRGLLPENERVEFSAPSGQDGEISS

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Asp/GUC/prokaryotic cytosol 65
U:Y tRNA (t) Ile/GAU/prokaryotic cytosol 65

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and site of action of the remaining four putative pseudouridine synthases in Escherichia coli. Del Campo M, Kaya Y, Ofengand J RNA [details] 11720289 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto