Full name: Serine/threonine-protein phosphatase PP1-1
Synonym: PPH1
GI: 6320156
Orf: D2693
COG: COG0639
UniProt: P20604
Structures: | |
Complex:
Enzyme type: protein phosphatase
Position of modification - modification:

Comments:

One of protein cofactors required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA. The enzyme that catalyzes the reaction is still unknown.

Protein sequence:

MVSRGPDEWLETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGG FPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVW KYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSP RGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVDEDL EPTFKIFSAVPDDYIRESTANHNNQRAGYFL

Publications:

Title Authors Journal Details PubMed Id DOI
A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae. Huang B, Lu J, Bystrom AS RNA [details] 18755837 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto