Full name: Thiosulfate sulfurtransferase TUM1
Synonym:
GI: 51012915
Orf:
COG: COG2897
UniProt: Q08686
Structures: | |
Complex:
Enzyme type: thiosulfate sulfurtransferase
Position of modification - modification:

Comments:

Part of eukaryotic sulfur-relay system required for in 2-thiolation of mcm5S2U at tRNA wobble positions.

Protein sequence:

MPLFDLISPKAFVKLVASEKVHRIVPVDATWYLPSWKLDNKVDFLTKPRIPNSIFFDIDAISDKKSPYPH MFPTKKVFDDAMSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREFKYPLDSSKV AAFSPYPKSHYESSESFQDKEIVDYEEMFQLVKSGELAKKFNAFDARSLGRFEGTEPEPRSDIPSGHIPG TQPLPYGSLLDPETKTYPEAGEAIHATLEKALKDFHCTLDPSKPTICSCGTGVSGVIIKTALELAGVPNV RLYDGSWTEWVLKSGPEWIAENRD

Publications:

Title Authors Journal Details PubMed Id DOI
Ubiquitin-related modifier Urm1 acts as a sulphur carrier in thiolation of eukaryotic transfer RNA. Leidel S, Pedrioli PG, Bucher T, Brost R, Costanzo M, Schmidt A, Aebersold R, Boone C, Hofmann K, Peter M Nature [details] 19145231 -
Mechanistic characterization of the sulfur-relay system for eukaryotic 2-thiouridine biogenesis at tRNA wobble positions. Noma A, Sakaguchi Y, Suzuki T Nucleic Acids Res [details] 19151091 -
A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae. Huang B, Lu J, Bystrom AS RNA [details] 18755837 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto