| Full name: | Adenylyltransferase and sulfurtransferase UBA4 | 
|---|---|
| Synonym: | NCS3 | 
| GI: | 6321903 | 
| COG: | COG0476 | 
| UniProt: | P38820 | 
| Alpha Fold Predicted Structure: | AF-P38820-F1 | 
| Enzyme type: | adenylyltransferase, sulfurtransferase | 
MNDYHLEDTTSELEALRLENAQLREQLAKREDSSRDYPLSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVRLNSSNAFDIFKGYNYILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTPPPPNAVTSCQEGGVIGPCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRGRQEKCLCCGKNRTITKEAIEKGEINYELFCGARNYNVCEPDERISVDAFQRIYKDDEFLAKHIFLDVRPSHHYEISHFPEAVNIPIKNLRDMNGDLKKLQEKLPSVEKDSNIVILCRYGNDSQLATRLLKDKFGFSNVRDVRGGYFKYIDDIDQTIPKY
Part of eukaryotic sulfur-relay system required for in 2-thiolation of mcm5S2U at tRNA wobble positions.
| Alpha Fold Pdb Files | AF-P38820-F1.pdb   | 
| Alpha Fold Pdbx/mmCIF Files | AF-P38820-F1.cif   | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Ubiquitin-related modifier Urm1 acts as a sulphur carrier in thiolation of eukaryotic transfer RNA. | Leidel S, Pedrioli PG, Bucher T, Brost R, Costanzo M, Schmidt A, Aebersold R, Boone C, Hofmann K, Peter M | Nature | [details] | 19145231 | - | 
| Mechanistic characterization of the sulfur-relay system for eukaryotic 2-thiouridine biogenesis at tRNA wobble positions. | Noma A, Sakaguchi Y, Suzuki T | Nucleic Acids Res | [details] | 19151091 | - | 
| A genome-wide screen identifies genes required for formation of the wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine in Saccharomyces cerevisiae. | Huang B, Lu J, Bystrom AS | RNA | [details] | 18755837 | - | 
| Thio-modification of yeast cytosolic tRNA requires a ubiquitin-related system that resembles bacterial sulfur transfer systems. | Nakai Y, Nakai M, Hayashi H | J Biol Chem | [details] | 18664566 | - |