Full name: RNA-capping enzyme
Synonym: HCE, mRNA 5'-triphosphatase, GTP--RNA guanylyltransferase
GI: 6685628
Orf: RNGTT
COG: COG5226
UniProt: O60942
Structures: | 3S24 |
Complex:
Enzyme type: triphosphatase, guanylyltransferase
Position of modification - modification: m:0 - m7Gpp(pN)

Comments:

Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part.

Protein sequence:

MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNT SRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAF LVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDEDEDEDGKKES EPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQN IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICT SRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLY VGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFE FIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT

Enzymatic activities:

Reaction Substrate Type Position
pp(pN):p(pN) mRNA (m) 0
p(pN):Gpp(pN) mRNA (m) 0

Publications:

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme. Yamada-Okabe T, Doi R, Shimmi O, Arisawa M, Yamada-Okabe H Nucleic Acids Res [details] 9512541 -
Cloning and characterization of two human cDNAs encoding the mRNA capping enzyme. Tsukamoto T, Shibagaki Y, Murakoshi T, Suzuki M, Nakamura A, Gotoh H, Mizumoto K Biochem Biophys Res Commun [details] 9473487 -
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ J Biol Chem [details] 9705270 -
Structure of the guanylyltransferase domain of human mRNA capping enzyme. Chu C, Das K, Tyminski JR, Bauman JD, Guan R, Qiu W, Montelione GT, Arnold E, Shatkin AJ Proc Natl Acad Sci U S A [details] 21636784 -

Links:

_Wikipedia_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto