Full name: RNA cap guanine-N7 methyltransferase
Synonym: mRNA cap methyltransferase, RG7MT1, hCMT1, hMet
GI: 74735378
Orf: RNMT, KIAA0398
COG: COG2226
UniProt: O43148
Structures: | 3EPP | 3BGV |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: m:1 - m7Gpp(pN)

Comments:

RNMT catalyzes methylation of the cap at the N-7 position to create the methyl cap, m7G(5')ppp(5')X. RNMT can only catalyze methylation of guanosine when it is a component of a cap structure attached to a transcript. RAM (RNMT-Activating Mini protein)/Fam103a1 is required for efficient cap methylation in vitro and in vivo, and is indirectly required to maintain mRNA expression levels, for mRNA translation and for cell viability.

Protein sequence:

MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKES SSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKN LEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGG DLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD YPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ

Enzymatic activities:

Reaction Substrate Type Position
Gpp(pN):m7Gpp(pN) mRNA (m) 1

Publications:

Title Authors Journal Details PubMed Id DOI
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ J Biol Chem [details] 9705270 -
Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase. Tsukamoto T, Shibagaki Y, Niikura Y, Mizumoto K Biochem Biophys Res Commun [details] 9790902 -
Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes. Saha N, Schwer B, Shuman S J Biol Chem [details] 10347220 -
Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha. Wen Y, Shatkin AJ Genes Dev [details] 11114884 -
Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability. Shafer B, Chu C, Shatkin AJ Mol Cell Biol [details] 15767670 -
RAM/Fam103a1 is required for mRNA cap methylation. Gonatopoulos-Pournatzis T, Dunn S, Bounds R, Cowling VH Mol Cell [details] 22099306 -

Links:

_Wikipedia_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto