Modomics - A Database of RNA Modifications

Full name:	RNA cap guanine-N7 methyltransferase
Synonym:	mRNA cap methyltransferase, RG7MT1, hCMT1, hMet
GI:	74735378
Orf:	RNMT, KIAA0398
COG:	COG2226
UniProt:	O43148
Structures:	\| 3EPP \| 3BGV \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	m:1 - m7GpppN

Comments:

RNMT catalyzes methylation of the cap at the N-7 position to create the methyl cap, m7G(5')ppp(5')X. RNMT can only catalyze methylation of guanosine when it is a component of a cap structure attached to a transcript. RAM (RNMT-Activating Mini protein)/Fam103a1 is required for efficient cap methylation in vitro and in vivo, and is indirectly required to maintain mRNA expression levels, for mRNA translation and for cell viability.

Protein sequence:

MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEG
NSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDIT
VLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMM
LRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYE
EKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ

Enzymatic activities:

Reaction	Substrate	Type	Position
GpppN:m7GpppN	mRNA (m)		1

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes.	Pillutla RC, Yue Z, Maldonado E, Shatkin AJ	J Biol Chem	[details]	9705270	-
Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.	Tsukamoto T, Shibagaki Y, Niikura Y, Mizumoto K	Biochem Biophys Res Commun	[details]	9790902	-
Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes.	Saha N, Schwer B, Shuman S	J Biol Chem	[details]	10347220	-
Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha.	Wen Y, Shatkin AJ	Genes Dev	[details]	11114884	-
Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability.	Shafer B, Chu C, Shatkin AJ	Mol Cell Biol	[details]	15767670	-
RAM/Fam103a1 is required for mRNA cap methylation.	Gonatopoulos-Pournatzis T, Dunn S, Bounds R, Cowling VH	Mol Cell	[details]	22099306	-

Links:

_Wikipedia_

_Wikipedia_