Full name: cap methyltranferase 1
Synonym: hMTr1, FTSJD2, KIAA0082
GI: 74750894
Orf: FTSJD2, KIAA0082
COG: COG0293
UniProt: Q8N1G2
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: n:1 - m7GpppNm
m:1 - m7GpppNm

Comments:

hMTr1 protein transfers a methyl group from S-adenosylmethionine to the 2'-O-ribose of the first nucleotide of messenger RNA and small nuclear RNA. N(7) methylation of the guanosine cap is not required for hMTr1 activity.

Protein sequence:

MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGKQHSSDSFDDA FKADSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELN VDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLD GEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGP GGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL DNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLL YCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDH EFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFE LIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTE LPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNP IRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKF FYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA

Enzymatic activities:

Reaction Substrate Type Position
m7Gpp(pN):m7GpppNm mRNA (m) 1
m7Gpp(pN):m7GpppNm snRNA (sn) U1 1
m7Gpp(pN):m7GpppNm snRNA (sn) U2// 1
Gpp(pN):GpppNmN mRNA (m) 1
Gpp(pN):GpppNmN snRNA (sn) U1 1
Gpp(pN):GpppNmN snRNA (sn) U2// 1

Publications:

Title Authors Journal Details PubMed Id DOI
Characterization of hMTr1, a human Cap1 2'-O-ribose methyltransferase. Belanger F, Stepinski J, Darzynkiewicz E, Pelletier J J Biol Chem [details] 20713356 -
The human interferon-regulated ISG95 protein interacts with RNA polymerase II and shows methyltransferase activity. Haline-Vaz T, Silva TC, Zanchin NI Biochem Biophys Res Commun [details] 18533109 -
Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1. Monecke T, Dickmanns A, Ficner R Nucleic Acids Res [details] 19386620 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto