Full name: N6-adenosine-methyltransferase IME4
Synonym: Mrm(m6A), Spo8
GI: 1174426
Orf: YGL192W, G1337
COG: COG4725
UniProt: P41833
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: m:many - m6A

Comments:

Ime4 catalyses the AdoMet-dependent N6-methylation of internal adenosine in yeast mRNA, including mRNA coding for Ime4 (regulatory role). Like the MT-A70 human homolog, Sce-Ime4 works within a multiprotein complex and requires additional subunits, e.g. Kar4p, GI140396. While Mum2 and Slz1 interact and co-immunoprecipitate with Ime4, including mRNA coding for Ime4. The methyl group of m6A in mRNA can be removed by FTO/AlkB-like demethylase enzyme.

Protein sequence:

MINDKLVHFLIQNYDDILRAPLSGQLKDVYSLYISGGYDDEMQKLRNDKDEVLQFEQFWNDLQDIIFATP QSIQFDQNLLVADRPEKIVYLDVFSLKILYNKFHAFYYTLKSSSSSCEEKVSSLTTKPEADSEKDQLLGR LLGVLNWDVNVSNQGLPREQLSNRLQNLLREKPSSFQLAKERAKYTTEVIEYIPICSDYSHASLLSTSVY IVNNKIVSLQWSKISACQENHPGLIECIQSKIHFIPNIKPQTDISLGDCSYLDTCHKLNTCRYIHYLQYI PSCLQERADRETASENKRIRSNVSIPFYTLGNCSAHCIKKALPAQWIRCDVRKFDFRVLGKFSVVIADPA WNIHMNLPYGTCNDIELLGLPLHELQDEGIIFLWVTGRAIELGKESLNNWGYNVINEVSWIKTNQLGRTI VTGRTGHWLNHSKEHLLVGLKGNPKWINKHIDVDLIVSMTRETSRKPDELYGIAERLAGTHARKLEIFGR DHNTRPGWFTIGNQLTGNCIYEMDVERKYQEFMKSKTGTSHTGTKKIDKKQPSKLQQQHQQQYWNNMDMG SGKYYAEAKQNPMNQKHTPFESKQQQKQQFQTLNNLYFAQ

Enzymatic activities:

Reaction Substrate Type Position
A:m6A mRNA (m)   None

Publications:

Title Authors Journal Details PubMed Id DOI
Induction of sporulation in Saccharomyces cerevisiae leads to the formation of N6-methyladenosine in mRNA: a potential mechanism for the activity of the IME4 gene. Clancy MJ, Shambaugh ME, Timpte CS, Bokar JA Nucleic Acids Res [details] 12384598 -
Yeast targets for mRNA methylation. Bodi Z, Button JD, Grierson D, Fray RG Nucleic Acids Res [details] 20421205 -
RNA methylation by the MIS complex regulates a cell fate decision in yeast. Agarwala SD, Blitzblau HG, Hochwagen A, Fink GR... PLoS Genet [details] 22685417 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto