Modomics - A Database of RNA Modifications

Full name:	tRNA pseudouridine(55) synthase
Synonym:	YhbA
GI:	42560511
Orf:	yhbA, b3166
COG:	COG0130
UniProt:	P60340
Structures:	\| 1K8W \| 1R3F \| 1R3E \| 1SGV \| 1ZL3 \|
Complex:
Enzyme type:	pseudouridine synthase
Position of modification - modification:	t:55 - Y

Comments:

Site specific.

Protein sequence:

MSRPRRRGRDINGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLGEATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERP
VTFSAEQLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYELLFIRHEGNELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYL
RRLAVSKYPVERMVTLEHLRELVEQAEQQDIPAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRTSGAPLEGLVRVTEGENGKFIGMGEIDDE
GRVAPRRLVVEYPA

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	tRNA (t)		55

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Deletion of the Escherichia coli pseudouridine synthase gene truB blocks formation of pseudouridine 55 in tRNA in vivo, does not affect exponential growth, but confers a strong selective disadvantage in competition with wild-type cells.	Gutgsell N, Englund N, Niu L, Kaya Y, Lane BG, Ofengand J	RNA	[details]	11142385	-
Pre-steady-state kinetic analysis of the three Escherichia coli pseudouridine synthases TruB, TruA, and RluA reveals uniformly slow catalysis.	Wright JR, Keffer-Wilkes LC, Dobing SR, Kothe U	RNA	[details]	21998096	-
An arginine-aspartate network in the active site of bacterial TruB is critical for catalyzing pseudouridine formation.	Friedt J, Leavens FM, Mercier E, Wieden HJ, Kothe U...	Nucleic Acids Res	[details]	24371284	-