Modomics - A Database of RNA Modifications

Full name:	rRNA (uridine-2'-O-)-methyltransferase
Synonym:	avilamycin resistance 23S rRNA methyltransferase
GI:	60593969
Orf:	aviRb
COG:	COG0566
UniProt:	Q9F5K6
Structures:	\| 1X7O \| 1X7P \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:2479(2479) - Um

Comments:

Methylation site was determined for E. coli rRNA.

Protein sequence:

MARSRGERTPAARRITSRNARFQQWQALLGNRNKRTRAGEFLVMGVRPISLAVEHGWPVRTLLYDGQRELSKWARELLRTVRTEQIAMAPDLLMELGEKN
EAPPEVVAVVEMPADDLDRIPVREDFLGVLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKSVRSSTGSLFSLPAVRVPSPGEVMDWVEARRA
AGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRTLCDYTVSIPMAGSASSLNAANAATAILYEAVRQRISGRTATTP

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Um	rRNA (r)	LSU/23S/prokaryotic cytosol	2479

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
The avilamycin resistance determinants AviRa and AviRb methylate 23S rRNA at the guanosine 2535 base and the uridine 2479 ribose.	Treede I, Jakobsen L, Kirpekar F, Vester B, Weitnauer G, Bechthold A, Douthwaite S	Mol Microbiol	[details]	12828631	-
An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57.	Weitnauer G, Gaisser S, Trefzer A, Stockert S, Westrich L, Quiros LM, Mendez C, Salas JA, Bechthold A	Antimicrob Agents Chemother	[details]	11181344	-
Structure and function of the antibiotic resistance-mediating methyltransferase AviRb from Streptomyces viridochromogenes.	Mosbacher TG, Bechthold A, Schulz GE	J Mol Biol	[details]	15581897	-