Full name: tRNA pseudouridine(13) synthase
Synonym: YgbO
GI: 2501601
Orf: ygbO, b2745
COG: COG0585
UniProt: Q57261
Structures: | 1SB7 | 1SI7 | 1SZW |
Complex:
Enzyme type: pseudouridine synthase
Position of modification - modification: t:13 - Y

Comments:

Permuted.

Protein sequence:

MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVADALAKFLKIHA REVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRKLRLGALKGNAFTLVLREVSN RDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGAQRWAQTNTPVRDRNKRSFWLSAARSALFNQIVAER LKKADVNQVVDGDALQLAGRGSWFVATTEELAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVA AETELQALLVREKVEAARRAMLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE

Enzymatic activities:

Reaction Substrate Type Position
U:Y tRNA (t) Glu/SUC/prokaryotic cytosol 13

Publications:

Title Authors Journal Details PubMed Id DOI
A novel unanticipated type of pseudouridine synthase with homologs in bacteria, archaea, and eukarya. Kaya Y, Ofengand J RNA [details] 12756329 -
Crystal structure of the highly divergent pseudouridine synthase TruD reveals a circular permutation of a conserved fold. Hoang C, Ferre-D'Amare AR RNA [details] 15208439 -
Crystal structure of TruD, a novel pseudouridine synthase with a new protein fold. Kaya Y, Del Campo M, Ofengand J, Malhotra A J Biol Chem [details] 14999002 -
X-ray structure of tRNA pseudouridine synthase TruD reveals an inserted domain with a novel fold. Ericsson UB, Nordlund P, Hallberg BM FEBS Lett [details] 15135053 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto