Full name: rRNA cytydine C-5-methyltransferase
Synonym: kanamycin and tobramycin resistance 16S rRNA methyltransferase
GI: 383329552
Orf: efmM
COG:
UniProt: E9KIK3
Structures: | 3M4X |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1404(1404) - m5C

Comments:



Protein sequence:

MKEEATTLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDMVQTYHSEELQPAPYSNEG FLGTVNGKSFLHQAGYEYSQEPSAMIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQMKGKGLLVTNEIFP KRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGMFRKDPNAIKEWTEESPLYCQ KRQQEILSSAIKMLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLE KTIRIWPHKDQGEGHFVAKLTFHGQNQMHKEKKTRKKSKVQMTKEQEKLWTEFSNDFHYEATGRLLVFND HLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRD GNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRFH

Enzymatic activities:

Reaction Substrate Type Position
C:m5C rRNA (r) SSU/16S/prokaryotic cytosol 1404

Publications:

Title Authors Journal Details PubMed Id DOI
Intrinsic resistance to aminoglycosides in Enterococcus faecium is conferred by the 16S rRNA m5C1404-specific methyltransferase EfmM. Galimand M, Schmitt E, Panvert M, Desmolaize B, Douthwaite S, Mechulam Y, Courvalin P RNA [details] 21159796 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto