Full name: tRNA (guanine(26)-N(2))-dimethyltransferase
Synonym: hTRM1p
GI: 209862871
Orf: TRMT1
COG: COG1867
UniProt: Q9NXH9
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:26 - m2,2G

Comments:

Sequence is fairly similar to S. cerevisiae Trm1p, to C. elegans TRM1p and to homolog ORFs found in mouse and A. thaliana. Exists in two isoforms.

Protein sequence:

MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEGAAKIAFPSAN EVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLSEQEEEKVELKESENLASGDQ PRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRSVVANDASTRAVDLIRRNVQLNDVAHLVQPSQ ADARMLMYQHQRVSERFDVIDLDPYGSPATFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAM ALKSRACHEMALRIVLHSLDLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVG CGAFHLQRLGKASGVPSGRAKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPG RFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDA PASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWG PRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPR VSADAAPDCPETSNQTPPGPGAAAGPGID

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) many 26
m2G:m2,2G tRNA (t) many 26

Publications:

Title Authors Journal Details PubMed Id DOI
The human tRNA(m(2)(2)G(26))dimethyltransferase: functional expression and characterization of a cloned hTRM1 gene. Liu J, Straby KB... Nucleic Acids Res [details] 10982862 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto