Modomics - A Database of RNA Modifications

Full name:	tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI
Synonym:	pimT-like
GI:	5457862
Orf:	PAB0283
COG:	COG2519
UniProt:	Q9V1J7
Structures:	\| 3LGA \| 3LHD \| 3MB5 \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:58 - m1A t:57 - m1I

Comments:

Protein sequence:

MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEA
GVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQV
MRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI

Enzymatic activities:

Reaction	Substrate	Type	Position
A:m1A	tRNA (t)		58
A:m1A	tRNA (t)		57

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
A primordial RNA modification enzyme: the case of tRNA (m1A) methyltransferase.	Roovers M, Wouters J, Bujnicki JM, Tricot C, Stalon V, Grosjean H, Droogmans L	Nucleic Acids Res	[details]	14739239	-
Structural comparison of tRNA m(1)A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme conditions.	Guelorget A, Barraud P, Tisne C, Golinelli-Pimpaneau B	BMC Struct Biol	[details]	22168821	-
Dynamics of RNA modification by a multi-site-specific tRNA methyltransferase.	Hamdane D, Guelorget A, Guerineau V, Golinelli-Pimpaneau B...	Nucleic Acids Res	[details]	25217588	-
Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.	Guelorget A, Roovers M, Guerineau V, Barbey C, Li X, Golinelli-Pimpaneau B...	Nucleic Acids Res	[details]	20483913	-