Modomics - A Database of RNA Modifications

Full name:	tRNA (cytosine(38)-C(5))-methyltransferase
Synonym:
GI:	4758184
Orf:	TRDMT1
COG:	COG0270
UniProt:	O14717
Structures:	\| 1G55 \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:38 - m5C

Comments:

Dnmt2 is a methyltransferase with high sequence similarity to various enzymes from the eukaryotic DNA:methyltransferase family, which includes in particular Dnmt1 and Dnmt3 enzymes. Although it uses the same catalytic residues as other Dnmt enzymes, DNA methylation activity producing dm5C by Dnmt2 is weak, and both its existence and biological role are controversial. Instead, the enzmye displays robust tRNA Methylation activity to yield m5C at position 38 of tRNAs in vitro and in vivo. Mammalian substrates include tRNAs Asp, Gly, and Val. Dnmt2 homologues are widespread in eukaryotes, including certain single cellular eukaroytes, but only one bacterial homologue is known. Active enzymes have been confirmed in mammalia, Drosophila melanogaster, Saccharomyces pombe, and Entamoeba histolytica.

Protein sequence:

MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFL
HILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKYAMD
VENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY
IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGNSLNVHVVAKLIKILYE

Enzymatic activities:

Reaction	Substrate	Type	Position
C:m5C	tRNA (t)	Asp/8UC/unknown	38

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Methylation of tRNAAsp by the DNA methyltransferase homolog Dnmt2.	Goll MG, Kirpekar F, Maggert KA, Yoder JA, Hsieh CL, Zhang X, Golic KG, Jacobsen SE, Bestor TH...	Science	[details]	16424344	-
Structure of human DNMT2, an enigmatic DNA methyltransferase homolog that displays denaturant-resistant binding to DNA.	Dong A, Yoder JA, Zhang X, Zhou L, Bestor TH, Cheng X...	Nucleic Acids Res	[details]	11139614	-

Links:

_PubMed_

_PubMed_