Full name: tRNA (guanine(37)-N1)-methyltransferase
Synonym: KIAA1393, TRMT5
GI: 145275187
Orf:
COG: COG2520
UniProt: Q32P41
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m1G
t:37 - o2yW

Comments:

The activity was studied using yeast tRNAPhe and E. coli tRNALeu. It was shown to catalyze also I->m1I reaction in position 37 in E.coli tRNAAsp hence it is predicted to participate in the formation of m1I in position 37 of human tRNAAla.

Protein sequence:

MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTMPETETHERET ELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDKESRLIML DPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLPEGQDVTSGFSRIGHIAHLN LRDHQLSFKHLIGQVMIDKNPGITSAVNKINNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVY WNPRLSTEHSRITELLKPGDVLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVK VFNLDGKDFLQGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRNPENHEDPPLK RQRTAEAFSDEKTQIVSNT

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Phe/#AA/unknown 37
G:m1G tRNA (t) Leu/.AA/unknown 37

Publications:

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of the human tRNA-(N1G37) methyltransferase (TRM5) and comparison to the Escherichia coli TrmD protein. Brule H, Elliott M, Redlak M, Zehner ZE, Holmes WM Biochemistry [details] 15248782 -
Conservation of structure and mechanism by Trm5 enzymes. Christian T, Gamper H, Hou YM... RNA [details] 23887145 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto