Full name: tRNA (guanine-N(7)-)-methyltransferase
Synonym: TRMB
GI: 167004078
Orf: C12orf1
COG: COG0220
UniProt: Q9UBP6
Structures: | 3CKK |
Complex: TRMB/WDR4
Enzyme type: methyltransferase
Position of modification - modification: t:46 - m7G

Comments:

Homolog of yeast Trm8. Requires WDR4 protein for acitivity. The activity was assayed on yeast tRNAPhe. .

Protein sequence:

MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK EKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSN AMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

Enzymatic activities:

Reaction Substrate Type Position
G:m7G tRNA (t) Phe/#AA/unknown 46

Publications:

Title Authors Journal Details PubMed Id DOI
Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA. Alexandrov A, Martzen MR, Phizicky EM RNA [details] 12403464 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto