Full name: tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Synonym:
GI: 16445428
Orf:
COG: COG2319
UniProt: P57081
Structures: | |
Complex: TRMB/WDR4

Comments:

Homolog of yeast Trm82. Required for the formation of m7G by TRMB (non-catalytic subunit of the complex).

Protein sequence:

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFS KSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRL ELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGD GTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQL VYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

Publications:

Title Authors Journal Details PubMed Id DOI
Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA. Alexandrov A, Martzen MR, Phizicky EM RNA [details] 12403464 -
Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism. Shaheen R, Abdel-Salam GM, Guy MP, Alomar R, Abdel-Hamid MS, Afifi HH, Ismail SI, Emam BA, Phizicky EM, Alkuraya FS... Genome Biol [details] 26416026 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto