Full name: BCDIN3 domain containing
Synonym:
GI: 32171233
Orf:
COG:
UniProt: Q7Z5W3
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: pre-miRNA:0 - mm(pN)

Comments:

Methylation of the 5′ monophosphate of pre-miRNAs by BCDIN3D inhibits their processing by Dicer.

Protein sequence:

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILG LDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQR TRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRL RKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEK GKEKNRLSFQKQ

Enzymatic activities:

Reaction Substrate Type Position
(pN):m(pN) pre-miRNA () pre-miR-145//cytosolic 0
(pN):m(pN) pre-miRNA () pre-miR-23b//cytosolic 0
m(pN):mm(pN) pre-miRNA () pre-miR-145//cytosolic 0
m(pN):mm(pN) pre-miRNA () pre-miR-23b//cytosolic 0

Publications:

Title Authors Journal Details PubMed Id DOI
Human RNA Methyltransferase BCDIN3D Regulates MicroRNA Processing. Xhemalce B, Robson SC, Kouzarides T... Cell [details] 23063121 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto