Modomics - A Database of RNA Modifications

Full name: BCDIN3 domain containing
Synonym:
GI: 32171233
Orf:
COG:
UniProt: Q7Z5W3
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: pre-miRNA:0 - mmpN

Comments:

Methylation of the 5′ monophosphate of pre-miRNAs by BCDIN3D inhibits their processing by Dicer.

Protein sequence:

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDA
SREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPW
KCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ

Enzymatic activities:

Reaction Substrate Type Position
pN:mpN pre-miRNA () pre-miR-145//eukaryotic cytosol 0
pN:mpN pre-miRNA () pre-miR-23b//eukaryotic cytosol 0
mpN:mmpN pre-miRNA () pre-miR-145//eukaryotic cytosol 0
mpN:mmpN pre-miRNA () pre-miR-23b//eukaryotic cytosol 0

Publications:

Title Authors Journal Details PubMed Id DOI
Human RNA Methyltransferase BCDIN3D Regulates MicroRNA Processing. Xhemalce B, Robson SC, Kouzarides T... Cell [details] 23063121 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca