Full name: tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial
Synonym:
GI: 136242
Orf: YDR120C
COG: COG1867
UniProt: P15565
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:26 - m2,2G

Comments:

AdoMet is the methyl group donor. Site-specific. Monomeric enzyme. Carries out two succesive methylations to yield doubly methylated m22G. Mitochondrial and in nuclear/cytoplasmic compartments.

Protein sequence:

MEGFFRIPLKRANLHGMLKAAISKIKANFTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPIQQFNR DLSVTCIKAWDNLYGEECGQKRNNKKSKKKRCAETNDDSSKRQKMGNGSPKEAVGNSNRNEPYINILEAL SATGLRAIRYAHEIPHVREVIANDLLPEAVESIKRNVEYNSVENIVKPNLDDANVLMYRNKATNNKFHVI DLDPYGTVTPFVDAAIQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNL LKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSSTMTTYHCSRCGSYHNQPLGRISQREGR NNKTFTKYSVAQGPPVDTKCKFCEGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHRDQDDTYGTRKRIEG MLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAIWYVMQ KCDDEKKDLSKMNPNTTGYKILSAMPGWLSGTVKSEYDSKLSFAPNEQSGNIEKLRKLKIVRYQENPTKN WGPKARPNTS

Enzymatic activities:

Reaction Substrate Type Position
G:m2G tRNA (t) Val/CAC/prokaryotic cytosol 26
G:m2G tRNA (t) Pro/UGG/mitochondrial 26
G:m2G tRNA (t) Ser/UGA/mitochondrial 26
G:m2G tRNA (t) Thr/UAG/mitochondrial 26
G:m2G tRNA (t) Tyr/GUA/mitochondrial 26
G:m2G tRNA (t)   26
G:m2G tRNA (t) Ala/IGC/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Ala/IGC/prokaryotic cytosol 26
G:m2G tRNA (t) Arg/ICU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Arg/ICU/prokaryotic cytosol 26
G:m2G tRNA (t) Arg/ICG/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Arg/ICG/prokaryotic cytosol 26
G:m2G tRNA (t) Asn/GUU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Asn/GUU/prokaryotic cytosol 26
G:m2G tRNA (t) Leu/UAG/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Leu/UAG/prokaryotic cytosol 26
G:m2G tRNA (t) Leu/CAA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Leu/CAA/prokaryotic cytosol 26
G:m2G tRNA (t) Leu/UAA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Leu/UAA/prokaryotic cytosol 26
G:m2G tRNA (t) Lys/CUU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Lys/CUU/prokaryotic cytosol 26
G:m2G tRNA (t) Lys/SUU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Lys/SUU/prokaryotic cytosol 26
G:m2G tRNA (t) Met/CAU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Met/CAU/prokaryotic cytosol 26
G:m2G tRNA (t) Phe/GAA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Phe/GAA/prokaryotic cytosol 26
G:m2G tRNA (t) Ser/CGA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Ser/CGA/prokaryotic cytosol 26
G:m2G tRNA (t) Ser/UGA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Ser/UGA/prokaryotic cytosol 26
G:m2G tRNA (t) Ser/IGA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Ser/IGA/prokaryotic cytosol 26
G:m2G tRNA (t) Thr/IGU/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Thr/IGU/prokaryotic cytosol 26
G:m2G tRNA (t) Tyr/GUA/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Tyr/GUA/prokaryotic cytosol 26
G:m2G tRNA (t) Val/CAC/prokaryotic cytosol 26
m2G:m2,2G tRNA (t) Val/CAC/prokaryotic cytosol 26
G:m2G tRNA (t) Leu/UAA/mitochondrial 26
m2G:m2,2G tRNA (t) Leu/UAA/mitochondrial 26
G:m2G tRNA (t) Phe/GAA/mitochondrial 26
m2G:m2,2G tRNA (t) Phe/GAA/mitochondrial 26

Publications:

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of the TRM1 locus, a gene essential for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNA in Saccharomyces cerevisiae. Ellis SR, Morales MJ, Li JM, Hopper AK, Martin NC J Biol Chem [details] 2426253 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto