Modomics - A Database of RNA Modifications

Full name:	tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial
Synonym:
GI:	136242
Orf:	YDR120C
COG:	COG1867
UniProt:	P15565
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:26 - m2,2G

Comments:

AdoMet is the methyl group donor. Site-specific. Monomeric enzyme. Carries out two succesive methylations to yield doubly methylated m22G. Mitochondrial and in nuclear/cytoplasmic compartments.

Protein sequence:

MEGFFRIPLKRANLHGMLKAAISKIKANFTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPIQQFNRDLSVTCIKAWDNLYGEECGQKRNNKKSKKK
RCAETNDDSSKRQKMGNGSPKEAVGNSNRNEPYINILEALSATGLRAIRYAHEIPHVREVIANDLLPEAVESIKRNVEYNSVENIVKPNLDDANVLMYRN
KATNNKFHVIDLDPYGTVTPFVDAAIQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSI
DFYVRVFVKVKTSPIEVKNVMSSTMTTYHCSRCGSYHNQPLGRISQREGRNNKTFTKYSVAQGPPVDTKCKFCEGTYHLAGPMYAGPLHNKEFIEEVLRI
NKEEHRDQDDTYGTRKRIEGMLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEKKDLS
KMNPNTTGYKILSAMPGWLSGTVKSEYDSKLSFAPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNTS

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m2G	tRNA (t)	Val/CAC/prokaryotic cytosol	26
G:m2G	tRNA (t)	Pro/UGG/mitochondrion	26
G:m2G	tRNA (t)	Ser/UGA/mitochondrion	26
G:m2G	tRNA (t)	Thr/UAG/mitochondrion	26
G:m2G	tRNA (t)	Tyr/GUA/mitochondrion	26
G:m2G	tRNA (t)		26
G:m2G	tRNA (t)	Ala/IGC/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Ala/IGC/prokaryotic cytosol	26
G:m2G	tRNA (t)	Arg/ICU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Arg/ICU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Arg/ICG/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Arg/ICG/prokaryotic cytosol	26
G:m2G	tRNA (t)	Asn/GUU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Asn/GUU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Leu/UAG/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Leu/UAG/prokaryotic cytosol	26
G:m2G	tRNA (t)	Leu/CAA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Leu/CAA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Leu/UAA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Leu/UAA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Lys/CUU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Lys/CUU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Lys/SUU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Lys/SUU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Met/CAU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Met/CAU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Phe/GAA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Phe/GAA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Ser/CGA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Ser/CGA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Ser/UGA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Ser/UGA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Ser/IGA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Ser/IGA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Thr/IGU/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Thr/IGU/prokaryotic cytosol	26
G:m2G	tRNA (t)	Tyr/GUA/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Tyr/GUA/prokaryotic cytosol	26
G:m2G	tRNA (t)	Val/CAC/prokaryotic cytosol	26
m2G:m2,2G	tRNA (t)	Val/CAC/prokaryotic cytosol	26
G:m2G	tRNA (t)	Leu/UAA/mitochondrion	26
m2G:m2,2G	tRNA (t)	Leu/UAA/mitochondrion	26
G:m2G	tRNA (t)	Phe/GAA/mitochondrion	26
m2G:m2,2G	tRNA (t)	Phe/GAA/mitochondrion	26

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Isolation and characterization of the TRM1 locus, a gene essential for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNA in Saccharomyces cerevisiae.	Ellis SR, Morales MJ, Li JM, Hopper AK, Martin NC	J Biol Chem	[details]	2426253	-