Full name: tRNA threonylcarbamoyladenosine dehydratase A
Synonym: YgdL, CsdL
GI: 16130719
Orf: csdL
COG: COG1179
UniProt: Q46927
Structures: | 4RDI | 4RDH | 4D7A | 4D79 |
Complex:
Enzyme type: dehydratase
Position of modification - modification: t:37 - ct6A

Comments:

TcdA is an ATP-dependent dehydratase necessary for the conversion of t6A to ct6A. CsdA and CsdE are additional factors involved in ct6A formation. The detailed catalytic mechanism of TcdA and the supportive roles of CsdA and CsdE in ct6A are not known yet.

Protein sequence:

MSVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNT NRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIA YCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEAL VYPQSDGTVCAMKATAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMMAKAARQG

Enzymatic activities:

Reaction Substrate Type Position
t6A:ct6A tRNA (t) Asn/GUU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Arg/UCU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Arg/CCU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Ile/CAU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Ile/GAU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Lys/SUU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Met/MAU/prokaryotic cytosol 37
t6A:ct6A tRNA (t) Ser/GCU/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
A cyclic form of N(6)-threonylcarbamoyladenosine as a widely distributed tRNA hypermodification. Miyauchi K, Kimura S, Suzuki T... Nat Chem Biol [details] 23242255 -
The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N-Threonylcarbamoyladenosine Dehydratase Activity. Kim S, Lee H, Park S... J Mol Biol [details] 26101842 -
The crystal structure and small-angle X-ray analysis of CsdL/TcdA reveal a new tRNA binding motif in the MoeB/E1 superfamily. Lopez-Estepa M, Arda A, Savko M, Round A, Shepard WE, Bruix M, Coll M, Fernandez FJ, Jimenez-Barbero J, Vega MC... PLoS One [details] 25897750 -

Links:

_PubMed_
_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto