Full name: tRNA methyltransferase 10 C, mitochondrial
Synonym: MRPP1, RG9MTD1
GI: 117647226
Orf:
COG:
UniProt: Q7L0Y3
Structures: | |
Complex: mtRNase P
Enzyme type: methyltransferase
Position of modification - modification: t:9 - m1G
t:9 - m1A

Comments:

Part of mitochondrial RNase P which consists of three proteins: MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391. All three are required for the enzyme endonuclease activity while two (MRPP1/TRMT10C, MRPP2/HSD17B10) are sufficient for methyltransferase activity. MRPP1/TRMT10C is a homolog of yeast Trm10 but unlike the yeast enzyme TRMT10C requires another protein, MRPP2/HSD17B10, to be active as a methyltransferase. Both precursors and mature tRNAs are substrates for the methyltransferase complex.

Protein sequence:

MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTM KSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKE KVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMA YENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVD LFPKDSIIYLTADSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKN LTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAKT

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Ile/GAU/prokaryotic cytosol 9
A:m1A tRNA (t) Lys/∀UU/mitochondrial 9

Publications:

Title Authors Journal Details PubMed Id DOI
A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis. Vilardo E, Nachbagauer C, Buzet A, Taschner A, Holzmann J, Rossmanith W... Nucleic Acids Res [details] 23042678 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto