Full name: 3-hydroxyacyl-CoA dehydrogenase type-2
Synonym: SDR5C1, ERAB, HADH2, MRPP2, SCHAD, XH98G2
GI: 2492759
Orf:
COG: COG1028
UniProt: Q99714
Structures: | 1SO8 | 1U7T | 2O23 |
Complex: mtRNase P

Comments:

Part of mitochondrial RNase P which consists of three proteins: MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391. All three are required for the enzyme endonuclease activity while two (MRPP1/TRMT10C, MRPP2/HSD17B10) are sufficient for methyltransferase activity (for more information see the entry for MRPP1/TRMT10C which is the catalytic compound in this complex).

Protein sequence:

MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNE PDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLP EKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Publications:

Title Authors Journal Details PubMed Id DOI
A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis. Vilardo E, Nachbagauer C, Buzet A, Taschner A, Holzmann J, Rossmanith W... Nucleic Acids Res [details] 23042678 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto