Full name: Ribosomal RNA large subunit methyltransferase O
Synonym: TTHA1493
GI: 55981462
Orf:
COG: COG1092
UniProt: Q5SI81
Structures: | 4DMG |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1964(1942) - m5C

Comments:

RlmO modifies naked 23 S rRNA, but not the assembled 50 S subunit or 70 S ribosomes.

Protein sequence:

MLGPVLRLVVKAGKERKLRNFYPNLYRDEIAAPPEGVGVAEAVDAEGHFLAVGYYDPRSRVPFRAFRFDP GPLNRAFFQGRFARALRRRQGLGESHRLVHGEADGLPGLVVDRFGEVLVLQVRSRGMEALREVWLPALLE VVAPKGVYERSDVEARRQEGLPERVGVVYGEVPEVLEVEEDGLRFPIPLALAQKTGYYLDQRENRRLFEA MVRPGERVLDVYSYVGGFALRAARKGAYALAVDKDLEALGVLDQAALRLGLRVDIRHGEALPTLRGLEGP FHHVLLDPPTLVKRPEELPAMKRHLVDLVREALRLLAEEGFLWLSSCSYHLRLEDLLEVARRAAADLGRR LRVHRVTYQPEDHPWSLHIPESLYLKTLVLQDDPL

Enzymatic activities:

Reaction Substrate Type Position
C:m5C rRNA (r) LSU/23S/prokaryotic cytosol 1964

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and characterization of the Thermus thermophilus 5-methylcytidine (m5C) methyltransferase modifying 23 S ribosomal RNA (rRNA) base C1942. Larsen LH, Rasmussen A, Giessing AM, Jogl G, Kirpekar F... J Biol Chem [details] 22711535 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto