Full name: Ribosomal RNA Cytosine Methyltransferase 1
Synonym: Ynl022c
GI: 398365407
Orf: N2815
COG: COG0144
UniProt: P53972
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2278(1935) - m5C

Comments:

The loss of m5C2278 results in anisomycin hypersensitivity. A combined loss of m5C2278 and Gm2288 cause dramatic ribosome instability, resulting in loss of 60S ribosomal subunits. Rcm1 interacts with Trm112 but deletion of Trm112 has no significant effect on the modification state of cytosine 2278.

Protein sequence:

MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKAHI LEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLKVRELSEL VLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLKVDKWSELVPGSIYYDEFIPNLFGIHPS DKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFE KDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKID DKDDDGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFERD

Enzymatic activities:

Reaction Substrate Type Position
C:m5C rRNA (r) LSU-L/25S/cytosolic 2278

Publications:

Title Authors Journal Details PubMed Id DOI
Yeast Nop2 and Rcm1 methylate C2870 and C2278 of the 25S rRNA, respectively. Sharma S, Yang J, Watzinger P, Kotter P, Entian KD... Nucleic Acids Res [details] 23913415 -
Methylation of ribosomal RNA by NSUN5 is a conserved mechanism modulating organismal lifespan. Schosserer M, Minois N, Angerer TB, Amring M, Dellago H, Harreither E, Calle-Perez A, Pircher A, Gerstl MP, Pfeifenberger S, Brandl C, Sonntagbauer M, Kriegner A, Linder A, Weinhausel A, Mohr T, Steiger M, Mattanovich D, Rinnerthaler M, Karl T, Sharma S, Entian KD, Kos M, Breitenbach M, Wilson IB, Polacek N, Grillari-Voglauer R, Breitenbach-Koller L, Grillari J... Nat Commun [details] 25635753 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto