Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA Cytosine Methyltransferase 1
Synonym:	Ynl022c
GI:	398365407
Orf:	N2815
COG:	COG0144
UniProt:	P53972
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	l:2278(1935) - m5C

Comments:

The loss of m5C2278 results in anisomycin hypersensitivity. A combined loss of m5C2278 and Gm2288 cause dramatic ribosome instability, resulting in loss of 60S ribosomal subunits. Rcm1 interacts with Trm112 but deletion of Trm112 has no significant effect on the modification state of cytosine 2278.

Protein sequence:

MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQ
KRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLKVDKWSELVPGSIYYDEF
IPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP
NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIV
YSTCSIHAEENERVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFERD

Enzymatic activities:

Reaction	Substrate	Type	Position
C:m5C	rRNA (r)	LSU-L/25S/eukaryotic cytosol	2278

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Yeast Nop2 and Rcm1 methylate C2870 and C2278 of the 25S rRNA, respectively.	Sharma S, Yang J, Watzinger P, Kotter P, Entian KD...	Nucleic Acids Res	[details]	23913415	-
Methylation of ribosomal RNA by NSUN5 is a conserved mechanism modulating organismal lifespan.	Schosserer M, Minois N, Angerer TB, Amring M, Dellago H, Harreither E, Calle-Perez A, Pircher A, Gerstl MP, Pfeifenberger S, Brandl C, Sonntagbauer M, Kriegner A, Linder A, Weinhausel A, Mohr T, Steiger M, Mattanovich D, Rinnerthaler M, Karl T, Sharma S, Entian KD, Kos M, Breitenbach M, Wilson IB, Polacek N, Grillari-Voglauer R, Breitenbach-Koller L, Grillari J...	Nat Commun	[details]	25635753	-

Links:

_PubMed_
_SGD_

_PubMed_

_SGD_