Modomics - A Database of RNA Modifications

Full name: tRNA wybutosine-synthesizing protein 2
Synonym: TRMT12
GI: 74726289
Orf:
COG: COG2520
UniProt: Q53H54
Structures: | |
Complex:
Enzyme type: Alpha-amino-alpha-carboxypropyltransferase
Position of modification - modification: t:37 - o2yW

Comments:

It was demonstrated that human TYW2 (hTYW2) is active in yeast and can synthesize the yW of yeast tRNAPhe. Human TYW2 (hTYW2) was found to be amplified and overexpressed in breast cancer.

Protein sequence:

MRENVVVSNMERESGKPVAVVAVVTEPWFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQG
CSPAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVE
HVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLS
NIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQALGVSKVEKEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAE
TRIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLECCPCPSVG

Publications:

Title Authors Journal Details PubMed Id DOI
Structure-function analysis of human TYW2 enzyme required for the biosynthesis of a highly modified Wybutosine (yW) base in phenylalanine-tRNA. Rodriguez V, Vasudevan S, Noma A, Carlson BA, Green JE, Suzuki T, Chandrasekharappa SC PLoS One [details] 22761755 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca