Full name:
Synonym:
GI: 6322095
Orf: YIL096C
COG:
UniProt: P40493
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2634(2265) - m3U

Comments:

Localizes in the nucleolus.

Protein sequence:

MARKLKGKIGSKGLKGALLRHKAKVKLVRNIESKQKHELRKKNSSANNKTVKRNQEFQKLNQGKVMPFEK DETLMLCGEGDFSFARSIVEQNYIESDNLIITSYDNSVNELKLKYPHTFEENYQYLKDLNIPIFFQIDVT KLVKSFKISKNNTWFKIINRLSDHRWGNKPLQNIVFNFPHNGKGIKDQERNIREHQDLIFNFFQNSLQLF NLINTKIQNDTLRYTQGYDLNEDTPQAKKLTAEGYGNIILSLFDGEPYDSWQIKLLAKKNGLTLSRSSKF QWENFPGYHHRRTNSEQDTTKPAKERDARFYIFSKYVSNSSKHNRKSKKDTDSDSD

Enzymatic activities:

Reaction Substrate Type Position
U:m3U rRNA (r) LSU-L/25S/cytosolic 2634

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of novel methyltransferases, Bmt5 and Bmt6, responsible for the m3U methylations of 25S rRNA in Saccharomyces cerevisiae. Sharma S, Yang J, Duttmann S, Watzinger P, Kotter P, Entian KD... Nucleic Acids Res [details] 24335083 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto