Full name:
Synonym: YLR063W
GI: 6323092
Orf: L2174
COG:
UniProt: Q12291
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2843(2474) - m3U

Comments:

Localized predominantly in the cytoplasm.

Protein sequence:

MLLMRRFAFLTSSVYFKYIPIYSQYHYSSQFPINMNPKKVAQLPVHNKSTLPPQEIIDLFKITFLEELYP KDQDNEKSPLTEQIQAVKSDLYNRDYNAAFNNDSKRIAYCCRWSPSRATSYASVFAHFPELLKIIRCEID DKDSNVLCIGGGAGGELVALASIFTLSRDFSSKFASALKIDNEVNKKPRNLNIQLVDIADWSTVVEKLTA TIKSKWLYGDSEAESFNVNFTHKDCLQMTEPQDIKIYQGLDLITLLFTTNELFTQKKVESIKFLQRLNEN CAPGCHLLILESAGSYSHITINNKKFPIQFLIDTILVGNRKDKGTTGPWSLVSENDSIWYRMDPKLDYSI PLENMRFFYRLYVKN

Enzymatic activities:

Reaction Substrate Type Position
U:m3U rRNA (r) LSU-L/25S/cytosolic 2843

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of novel methyltransferases, Bmt5 and Bmt6, responsible for the m3U methylations of 25S rRNA in Saccharomyces cerevisiae. Sharma S, Yang J, Duttmann S, Watzinger P, Kotter P, Entian KD... Nucleic Acids Res [details] 24335083 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto