Modomics - A Database of RNA Modifications

Full name:	tRNA (guanine(37)-N1)-methyltransferase Trm5a/Taw22
Synonym:	Trm5a
GI:	14520331
Orf:	PAB2272
COG:	COG2520
UniProt:	Q9V2G1
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:37 - mimG

Comments:

In P. abyssi two paralogs capable of forming m1G37 are present: Trm5b and Taw22 (Trm5a, a bifunctional enzyme). Under identical experimental conditions Taw22 is more selective for G37-containing tRNAPhe. Taw22 is a tRNA:m1G/imG2 methyltransferase, acting on two chemically distinct guanosine derivatives located at the same position of tRNAPhe, unique to certain archaea. It does not have homologs in eukaryotes.

Protein sequence:

MSGVKVRREDAKKVLELLKSVGILDGKRKAIRDEKYVIFPVTDTNIAKSLGLEVVDVELPMRPERQIYKN LEDLLPREIFKKLGRLDIVGDIAIVSIPDEILSEREVIVSAIRKLYPKVKVIARRGFHSGLYRIRELEVI WGENRLHTIHKENGVLIKVDLSKVFFNPRMKGERYRIAQLVNDGERILVPFAGVIPYPLVIARFKNVEVY AVEINEFAVKLAEENLELNRDRLKGKIKIIHGDVFEVLPNLPNFDRVVSPTPKGVDALSLTLSKAEKFLH YYDFVHESEIERFRERVLEECRRQGKECRVSVRKVSDYKPHVYKVCADVEILS

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m1G	tRNA (t)	Phe/GAA/prokaryotic cytosol	37
imG-14:imG2	tRNA (t)	Phe/GAA/prokaryotic cytosol	37

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea.	de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H	Mol Biol Evol	[details]	20382657	-
Biosynthesis of wyosine derivatives in tRNA(Phe) of Archaea: role of a remarkable bifunctional tRNA(Phe):m1G/imG2 methyltransferase.	Urbonavicius J, Meskys R, Grosjean H...	RNA	[details]	24837075	-