Full name: tRNA (guanine(37)-N1)-methyltransferase Trm5b
Synonym:
GI: 14520947
Orf: PAB0505
COG: COG2520
UniProt: Q9V0Q0
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - yW-72

Comments:

In P. abyssi two paralogs capable of forming m1G37 are present: Trm5b and Taw22 (Trm5a, a bifunctional enzyme).

Protein sequence:

MTLAVKVPLKEGEIVRRRLIELGALDNTYKIKREGNFLLIPVKFPVKGFEVVEAELEQVSRRPNSYREIV NVPQELRRFLPTSFDIIGNIAIIEIPEELKGYAKEIGRAIVEVHKNVKAVYMKGSKIEGEYRTRELIHIA GENITETIHRENGIRLKLDVAKVYFSPRLATERMRVFKMAQEGEVVFDMFAGVGPFSILLAKKAELVFAC DINPWAIKYLEENIKLNKVNNVVPILGDSREIEVKADRIIMNLPKYAHEFLEHAISCINDGGVIHYYGFG PEGDPYGWHLERIRELANKFGVKVEVLGKRVIRNYAPRQYNIAIDFRVSF

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) 37

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H Mol Biol Evol [details] 20382657 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto