| Full name: | S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase | 
|---|---|
| Synonym: | Tyw1 | 
| GI: | 14520684 | 
| Orf: | PAB2039 | 
| COG: | COG0731 | 
| UniProt: | Q9V1F9 | 
| Alpha Fold Predicted Structure: | AF-Q9V1F9-F1 | 
| Enzyme type: | oxidoreductase | 
| Position of modification - modification: | 
                            t:37 - mimG  | 
                
MREMITIKPGKITVQANPNMPEEVANLFRKQHYEIVGRHSGVKLCHWLKKSLTEGRFCYKQKFYGIHSHRCLQMTPVLAWCTHNCIFCWRPMETFLGTELPQPWDDPEFIVEESIKAQRKLLIGYKGNPKVDKKKFEEAWEPKHAAISLSGEPMLYPYMGDLVEEFHKRGFTTFIVTNGTVPERLEEMIKEDKLPTQLYVSITAPDIETYNSVNIPMIPDGWERIMRFLELMRDLPTRTVVRLTLVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYSRNRLTINNMPSHQDIREFAEALVKHLPGYHIEDEYEPSRVVLIMRDDVDPQGTGVNGRFIKH
Homolog of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References | 
|---|---|---|---|---|---|---|---|---|---|---|
| m1G:imG-14 | tRNA (t) | Phe/GAA/prokaryotic cytosol | 37 | 23043105    | 
| Alpha Fold Pdb Files | AF-Q9V1F9-F1.pdb   | 
| Alpha Fold Pdbx/mmCIF Files | AF-Q9V1F9-F1.cif   | 
| DSSP Secondary Structures | Q9V1F9.dssp   | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| 4-Demethylwyosine synthase from Pyrococcus abyssi is a radical-S-adenosyl-L-methionine enzyme with an additional [4Fe-4S](+2) cluster that interacts with the pyruvate co-substrate. | Perche-Letuvee P, Kathirvelu V, Berggren G, Clemancey M, Latour JM, Maurel V, Douki T, Armengaud J, Mulliez E, Fontecave M, Garcia-Serres R, Gambarelli S, Atta M... | J Biol Chem | [details] | 23043105 | - |