Full name: | S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase |
---|---|
Synonym: | Tyw1 |
GI: | 14520684 |
Orf: | PAB2039 |
COG: | COG0731 |
UniProt: | Q9V1F9 |
Alpha Fold Predicted Structure: | AF-Q9V1F9-F1 |
Enzyme type: | oxidoreductase |
Position of modification - modification: |
t:37 - mimG |
MREMITIKPGKITVQANPNMPEEVANLFRKQHYEIVGRHSGVKLCHWLKKSLTEGRFCYKQKFYGIHSHRCLQMTPVLAWCTHNCIFCWRPMETFLGTELPQPWDDPEFIVEESIKAQRKLLIGYKGNPKVDKKKFEEAWEPKHAAISLSGEPMLYPYMGDLVEEFHKRGFTTFIVTNGTVPERLEEMIKEDKLPTQLYVSITAPDIETYNSVNIPMIPDGWERIMRFLELMRDLPTRTVVRLTLVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYSRNRLTINNMPSHQDIREFAEALVKHLPGYHIEDEYEPSRVVLIMRDDVDPQGTGVNGRFIKH
Homolog of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
m1G:imG-14 | tRNA (t) | Phe/GAA/prokaryotic cytosol | 37 | 23043105    |
Alpha Fold Pdb Files | AF-Q9V1F9-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-Q9V1F9-F1.cif   |
DSSP Secondary Structures | Q9V1F9.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
4-Demethylwyosine synthase from Pyrococcus abyssi is a radical-S-adenosyl-L-methionine enzyme with an additional [4Fe-4S](+2) cluster that interacts with the pyruvate co-substrate. | Perche-Letuvee P, Kathirvelu V, Berggren G, Clemancey M, Latour JM, Maurel V, Douki T, Armengaud J, Mulliez E, Fontecave M, Garcia-Serres R, Gambarelli S, Atta M... | J Biol Chem | [details] | 23043105 | - |