Full name: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
Synonym: Tyw1
GI: 14520684
Orf: PAB2039
COG: COG0731
UniProt: Q9V1F9
Structures: | |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:37 - mimG

Comments:

Homolog of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.

Protein sequence:

MREMITIKPGKITVQANPNMPEEVANLFRKQHYEIVGRHSGVKLCHWLKKSLTEGRFCYKQKFYGIHSHR CLQMTPVLAWCTHNCIFCWRPMETFLGTELPQPWDDPEFIVEESIKAQRKLLIGYKGNPKVDKKKFEEAW EPKHAAISLSGEPMLYPYMGDLVEEFHKRGFTTFIVTNGTVPERLEEMIKEDKLPTQLYVSITAPDIETY NSVNIPMIPDGWERIMRFLELMRDLPTRTVVRLTLVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYS RNRLTINNMPSHQDIREFAEALVKHLPGYHIEDEYEPSRVVLIMRDDVDPQGTGVNGRFIKH

Enzymatic activities:

Reaction Substrate Type Position
m1G:imG-14 tRNA (t) Phe/GAA/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
4-Demethylwyosine synthase from Pyrococcus abyssi is a radical-S-adenosyl-L-methionine enzyme with an additional [4Fe-4S](+2) cluster that interacts with the pyruvate co-substrate. Perche-Letuvee P, Kathirvelu V, Berggren G, Clemancey M, Latour JM, Maurel V, Douki T, Armengaud J, Mulliez E, Fontecave M, Garcia-Serres R, Gambarelli S, Atta M... J Biol Chem [details] 23043105 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto