Modomics - A Database of RNA Modifications

Full name: tRNA (cytosine(49)-C(5))-methyltransferase
Synonym: PYRAB06230
GI: 14520840
Orf: PAB1947
COG: COG0144
UniProt: Q9V106
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:49 - m5C

Comments:

Catalyzes m5C formation at several cytosines within tRNAs, with preference for C49. The specificity of the enzyme is increased by complex formation with protein archease (PAB1946) encoded upstream from the MTase gene (PAB1947).

Protein sequence:

MKRWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVIVNVNKVEKKEVREVEVEGEDLESLLYNFLEELLVIHDIEGLVFRDFEVKIEKTEKGYKLKAKA
YGEKLDPEKHEPKEEVKAITYHDMKIEKLPDGRWMAQLVPDI

Enzymatic activities:

Reaction Substrate Type Position
C:m5C tRNA (t)   49

Publications:

Title Authors Journal Details PubMed Id DOI
Archease from Pyrococcus abyssi improves substrate specificity and solubility of a tRNA m5C methyltransferase. Auxilien S, El Khadali F, Rasmussen A, Douthwaite S, Grosjean H... J Biol Chem [details] 17470432 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca