Full name: glutamine:preQ0-tRNA amidinotransferase or Archaeosine Synthase
Synonym: Archaeosine synthase, Glutamine:preQ0-tRNA amidinotransferase
GI: 3024970
Orf:
COG: COG1549
UniProt: Q58428
Structures: | |
Complex:
Enzyme type: amidinotransferase
Position of modification - modification: t:15 - G+

Comments:



Protein sequence:

MLEPIAYDIGRLCKEEDKELTPKLIDIDVIGLSQEKIFYGIMTPFRCPNSKSIYELRKSYVKADGIKMPF DTFRELTSIFKKSFIGTVKYKGNVFKYQILNFGKHVDLIELEDADLYIIADGRRLIERKELQIIPKIREK ISPNSAIYSPAVFPWEIPLLAYIGVDYFDDSLAKLYASMGYKFTKNRAVKVDSFSFEELYNNNKKVYEEI LEEVRIAIKNGFLRNVVEETAVSHPYLWANYRRYEPDLRNIPLSKENKIIVTTNINIPEVKKYLERLDNY EPYSNIIVLLPCSSKKPYSISQSHQKFIKAIKSAKVVVEEVILTSPYGLVPRALERLVNYDIPVTGEWSF EEIELINNCLKNFLKKVKEKFDDYIVIAHLPEHYLEILELDDIVITSKGNPTSEEALKNLTDTLKKYKEL TKSKDINKKGQRIHNIQQLAEFQFGINFIPNEIFINHKGQIFTKINNKNQQIASINPKNGLLILTLSGGE LLWNSGGKDINYIEVNYEIKKGSLFPPGFVDCNENISYNDEVVLIKDDTFLGIGRALMSGFEMKKAKHGA LVNIRNVKS

Enzymatic activities:

Reaction Substrate Type Position
preQ0tRNA:G+ tRNA (t) 15

Publications:

Title Authors Journal Details PubMed Id DOI
Discovery and characterization of an amidinotransferase involved in the modification of archaeal tRNA. Phillips G, Chikwana VM, Maxwell A, El-Yacoubi B, Swairjo MA, Iwata-Reuyl D, de Crecy-Lagard V... J Biol Chem [details] 20129918 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto