Full name: tRNA methyltransferase 10 homolog A
Synonym: RG9MTD2
GI: 22748659
Orf:
COG:
UniProt: Q8TBZ6
Structures: | 4FMW |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:9 - m1G

Comments:

Ortholog of yeast Trm10, cytoplasmic. TRMT10A deficiency accounts for abnormalities in glucose homeostasis.

Protein sequence:

MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRK RKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQ FYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVD HNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVP TDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) 9

Publications:

Title Authors Journal Details PubMed Id DOI
A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis. Vilardo E, Nachbagauer C, Buzet A, Taschner A, Holzmann J, Rossmanith W... Nucleic Acids Res [details] 23042678 -
TRMT10A dysfunction is associated with abnormalities in glucose homeostasis, short stature and microcephaly. Gillis D, Krishnamohan A, Yaacov B, Shaag A, Jackman JE, Elpeleg O... J Med Genet [details] 25053765 -

Links:

_PubMed -_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto