Full name: tRNA methyltransferase 10 homolog B
Synonym: RG9MTD3
GI: 117606330
Orf:
COG:
UniProt: Q6PF06
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:9 - m1G

Comments:

Ortholog of yeast Trm10, cytoplasmic.

Protein sequence:

MDWKLEGSTQKVESPVLQGQEGILEETGEDGLPEGFQLLQIDAEGECQEGEILATGSTAWCSKNVQRKQR HWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKDKLLEAKHSGPRLCIDLSMTHYMSKK ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDSPLYEECVRMNDGFSSYLLDITEEDCFSLFPLETLVY LTPDSEHALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRNQNGKNYHSEILAIN QVFDILSTYLETHNWPEALKKGVSSGKGYILRNSVE

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) 9

Publications:

Title Authors Journal Details PubMed Id DOI
A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis. Vilardo E, Nachbagauer C, Buzet A, Taschner A, Holzmann J, Rossmanith W... Nucleic Acids Res [details] 23042678 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto