Modomics - A Database of RNA Modifications

Full name: Ribosomal RNA cytidine Acetyltransferase 1
Synonym: KRE33
GI: 6324197
Orf: N1216, N1858
COG: COG1444
UniProt: P53914
Structures: | |
Complex:
Enzyme type: acetyltransferase
Position of modification - modification: t:12 - ac4C
s:1773(1510) - ac4C
s:1280(1060) - ac4C

Comments:

RRA1 (KRE33) is a cytosine acetyltransferase with specificity towards both 18S rRNA and serine and leucine tRNAs. KRE33 is required for formation of ac4C1280 (helix 34) and ac4C1773 (helix 45) on 18S rRNA. KRE33 is required for pre-rRNA processing steps leading to 18S rRNA synthesis but 18S rRNA acetylation is not required for pre-rRNA processing. KRE33 is additionally required for ac4C12 on serine and leucine tRNAs. KRE33 interacts in vivo with TAN1. TAN1 is also required for tRNA acetylation but does not carry any acetyltransferase domain. On this basis, TAN1 was suggested to act as a tRNA adaptor to KRE33. NAT10 is the human homolog of KRE33 and THUMPD1 the human homolog of TAN1.

Protein sequence:

MAKKAIDSRIPSLIRNGVQTKQRSIFVIVGDRARNQLPNLHYLMMSADLKMNKSVLWAYKKKLLGFTSHRKKRENKIKKEIKRGTREVNEMDPFESFISN
QNIRYVYYKESEKILGNTYGMCILQDFEALTPNLLARTIETVEGGGIVVILLKSMSSLKQLYTMTMDVHARYRTEAHGDVVARFNERFILSLGSNPNCLV
VDDELNVLPLSGAKNVKPLPPKEDDELPPKQLELQELKESLEDVQPAGSLVSLSKTVNQAHAILSFIDAISEKTLNFTVALTAGRGRGKSAALGISIAAA
VSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHIDYDIIQSTNPDFNKAIVRVDIKRDHRQTIQYIVPQDHQVLGQAELVVIDEAAAIPLPIVKNL
LGPYLVFMASTINGYEGTGRSLSLKLIQQLRNQNNTSGRESTQTAVVSRDNKEKDSHLHSQSRQLREISLDEPIRYAPGDPIEKWLNKLLCLDVTLIKNP
RFATRGTPHPSQCNLFVVNRDTLFSYHPVSENFLEKMMALYVSSHYKNSPNDLQLMSDAPAHKLFVLLPPIDPKDGGRIPDPLCVIQIALEGEISKESVR
NSLSRGQRAGGDLIPWLISQQFQDEEFASLSGARIVRIATNPEYASMGYGSRAIELLRDYFEGKFTDMSEDVRPKDYSIKRVSDKELAKTNLLKDDVKLR
DAKTLPPLLLKLSEQPPHYLHYLGVSYGLTQSLHKFWKNNSFVPVYLRQTANDLTGEHTCVMLNVLEGRESNWLVEFAKDFRKRFLSLLSYDFHKFTAVQ
ALSVIESSKKAQDLSDDEKHDNKELTRTHLDDIFSPFDLKRLDSYSNNLLDYHVIGDMIPMLALLYFGDKMGDSVKLSSVQSAILLAIGLQRKNIDTIAK
ELNLPSNQTIAMFAKIMRKMSQYFRQLLSQSIEETLPNIKDDAIAEMDGEEIKNYNAAEALDQMEEDLEEAGSEAVQAMREKQKELINSLNLDKYAINDN
SEEWAESQKSLEIAAKAKGVVSLKTGKKRTTEKAEDIYRQEMKAMKKPRKSKKAAN

Enzymatic activities:

Reaction Substrate Type Position
C:ac4C rRNA (r) SSU/18S/eukaryotic cytosol 1773
C:ac4C rRNA (r) SSU/18S/eukaryotic cytosol 1280
C:ac4C tRNA (t) Leu/UAG/eukaryotic cytosol 12
C:ac4C tRNA (t) Leu/CAA/eukaryotic cytosol 12
C:ac4C tRNA (t) Leu/UAA/eukaryotic cytosol 12
C:ac4C tRNA (t) Ser/CGA/eukaryotic cytosol 12
C:ac4C tRNA (t) Ser/UGA/eukaryotic cytosol 12
C:ac4C tRNA (t) Ser/IGA/eukaryotic cytosol 12
C:ac4C tRNA (t) Ser/GCU/eukaryotic cytosol 12

Publications:

Title Authors Journal Details PubMed Id DOI
A single acetylation of 18S rRNA is essential for biogenesis of the small ribosomal subunit in Saccharomyces cerevisiae. Ito S, Akamatsu Y, Noma A, Kimura S, Miyauchi K, Ikeuchi Y, Suzuki T, Suzuki T... J Biol Chem [details] 25086048 -
Yeast Kre33 and human NAT10 are conserved 18S rRNA cytosine acetyltransferases that modify tRNAs assisted by the adaptor Tan1/THUMPD1. Sharma S, Langhendries JL, Watzinger P, Kotter P, Entian KD, Lafontaine DL... Nucleic Acids Res [details] 25653167 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca