Full name: rRNA methyltransferase 2, mitochondrial
Synonym: FTSJ2, FJH1
GI: 7019377
Orf:
COG: COG0293
UniProt: Q9UI43
Structures: | 2NYU |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1369(2552) - Um

Comments:

Mitochondrial.

Protein sequence:

MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQIL RPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRIL EVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTE EFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ

Enzymatic activities:

Reaction Substrate Type Position
U:Um rRNA (r) LSU/16S/mitochondrial 1369

Publications:

Title Authors Journal Details PubMed Id DOI
Assignment of 2'-O-methyltransferases to Modification Sites on the Mammalian Mitochondrial Large Subunit 16S rRNA. Lee KW, Bogenhagen DF... J Biol Chem [details] 25074936 -
MRM2 and MRM3 are involved in biogenesis of the large subunit of the mitochondrial ribosome. Rorbach J, Boesch P, Gammage PA, Nicholls TJ, Pearce SF, Patel D, Hauser A, Perocchi F, Minczuk M Mol Biol Cell [details] 25009282 10.1091/mbc.E14-01-0014
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto