MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTD PSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQ SRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
Reaction | Substrate | Type | Position |
---|---|---|---|
U:Um | rRNA (r) | LSU/16S/mitochondrion | 1369 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Assignment of 2'-O-methyltransferases to Modification Sites on the Mammalian Mitochondrial Large Subunit 16S rRNA. | Lee KW, Bogenhagen DF... | J Biol Chem | [details] | 25074936 | - |
MRM2 and MRM3 are involved in biogenesis of the large subunit of the mitochondrial ribosome. | Rorbach J, Boesch P, Gammage PA, Nicholls TJ, Pearce SF, Patel D, Hauser A, Perocchi F, Minczuk M | Mol Biol Cell | [details] | 25009282 | 10.1091/mbc.E14-01-0014 |