Full name: tRNA (guanine-N(1)-)-methyltransferase
Synonym:
GI: 731672
Orf: YHR070W
COG: COG2520
UniProt: P38793
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:37 - m1I
t:37 - yW
t:37 - m1G

Comments:

Trm5 methylates G or I at position 37. AdoMet is the methyl group donor. In wybutosine synthesis it methylates G37 of tRNAPhe to produce m1G37. Acts on cytoplasmic and mitochondrial tRNA.

Protein sequence:

MKIALPVFQKFNRLISSCKMSGVFPYNPPVNRQMRELDRSFFITKIPMCAVKFPEPKNISVFSKNFKNCI LRVPRIPHVVKLNSSKPKDELTSVQNKKLKTADGNNTPVTKGVLLHESIHSVEDAYGKLPEDALAFLKEN SAEIVPHEYVLDYDFWKAEEILRAVLPEQFLEEVPTGFTITGHIAHLNLRTEFKPFDSLIGQVILDKNNK IECVVDKVSSIATQFRTFPMKVIAGKSDSLVVEQKESNCTFKFDFSKVYWNSRLHTEHERLVKQYFQPGQ VVCDVFAGVGPFAVPAGKKDVIVLANDLNPESYKYLKENIALNKVAKTVKSFNMDGADFIRQSPQLLQQW IQDEEGGKITIPLPLKKRHRSQQHNDQQPPQPRTKELIIPSHISHYVMNLPDSAISFLGNFRGIFAAHTK GATDTIQMPWVHVHCFEKYPPGDQVTEDELHARVHARIIAALKVTADDLPLNAVSLHLVRKVAPTKPMYC ASFQLPANV

Enzymatic activities:

Reaction Substrate Type Position
G:m1G tRNA (t) Leu/UAG/prokaryotic cytosol 37
G:m1G tRNA (t) Leu/CAA/prokaryotic cytosol 37
G:m1G tRNA (t) Leu/UAA/prokaryotic cytosol 37
G:m1G tRNA (t) Pro/UGG/prokaryotic cytosol 37
G:m1G tRNA (t) His/GUG/prokaryotic cytosol 37
G:m1G tRNA (t) Asp/GUC/prokaryotic cytosol 37
G:m1G tRNA (t) Phe/GAA/mitochondrial 37
G:m1G tRNA (t) Ser/UGA/mitochondrial 37
G:m1G tRNA (t) Thr/UAG/mitochondrial 37
I:m1I tRNA (t) Ala/IGC/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA. Noma A, Kirino Y, Ikeuchi Y, Suzuki T EMBO J [details] 16642040 -
A primordial tRNA modification required for the evolution of life? Bjork GR, Jacobsson K, Nilsson K, Johansson MJ, Bystrom AS, Persson OP EMBO J [details] 11226173 -
Control of catalytic cycle by a pair of analogous tRNA modification enzymes. Christian T, Lahoud G, Liu C, Hou YM J Mol Biol [details] 20452364 -
Mechanism of N-methylation by the tRNA m1G37 methyltransferase Trm5. Christian T, Lahoud G, Liu C, Hoffmann K, Perona JJ, Hou YM RNA [details] 20980671 -
Yeast mitochondrial initiator tRNA is methylated at guanosine 37 by the Trm5-encoded tRNA (guanine-N1-)-methyltransferase. Lee C, Kramer G, Graham DE, Appling DR J Biol Chem [details] 17652090 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto