Modomics - A Database of RNA Modifications

Full name: tRNA-methyltransferase O
Synonym:
GI: 118600979
Orf: HSPC219
COG: COG1720
UniProt: Q9BU70
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t: - m6t6A

Comments:

Homolog of E. coli TrmO. The substrate recognition mechanism of human TRMO differs from that of E. coli TrmO - human tRNASer(GCU) has A31-U39 and C35, which should function as anti-determinants for E. coli TrmO.

Protein sequence:

MRGLEESGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAK
VQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQ
RQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQG
SRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFT
VDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS

Enzymatic activities:

Reaction Substrate Type Position
t6A:m6t6A tRNA (t) Ser/GCU/eukaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Discovery of the beta-barrel-type RNA methyltransferase responsible for N6-methylation of N6-threonylcarbamoyladenosine in tRNAs. Kimura S, Miyauchi K, Ikeuchi Y, Thiaville PC, de Crecy-Lagard V, Suzuki T... Nucleic Acids Res [details] 25063302 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca