Modomics - A Database of RNA Modifications

Full name: tRNA (cytosine-5-)-methyltransferase NSUN6
Synonym:
GI: 1189131264
Orf:
COG:
UniProt:
Structures: | 5WWT | 5WWQ | 5WWR | 5WWS | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification:

Comments:



Protein sequence:

MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTHLASVQHVKNLLLDELQKQFNGLSVPILQHPDLQDVLLIPV
IGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSGLPELKGMGIRMTE
PVYLSPSFDSVLPRYLFLQNLPSALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNSIRAFCFDGTKAVKL
DMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPLQRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQE
PQIGGEGMRGAGLSCEQLKQLQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST


Diseases connected to this enzyme:

Description Reaction Disease Name
Nsun6 was found to be an important factor that enables supress the pancreatic cancer cell proliferation C:m5C
Pancreatic cancer

Publications:

Title Authors Journal Details PubMed Id DOI
NSUN6 is a human RNA methyltransferase that catalyzes formation of m5C72 in specific tRNAs. Haag S, Warda AS, Kretschmer J, Günnigmann MA, Höbartner C, Bohnsack MT RNA [details] 26160102 10.1261/rna.051524.115
Sequence-specific and Shape-selective RNA Recognition by the Human RNA 5-Methylcytosine Methyltransferase NSun6. Long T, Li J, Li H, Zhou M, Zhou XL, Liu RJ, Wang ED J Biol Chem [details] 27703015 10.1074/jbc.M116.742569
Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6. Liu RJ, Long T, Li J, Li H, Wang ED Nucleic Acids Res [details] 28531330 10.1093/nar/gkx473

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca