Modomics - A Database of RNA Modifications

Full name: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase
Synonym: Ncl1p
GI: 586408
Orf: YBL024W
COG: COG0144
UniProt: P38205
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:34 - m5C
t:40 - m5C
t:48 - m5C

Comments:

AdoMet is the methyl group donor. Multisite specific. Monomeric enzyme. In most mature tRNAs modifies either 48 or 49, in just two tRNAs modifies either 34 or 40, but only before the intron is removed. In yeast, the activity of Trm4 and consequently the degree of m5C modification in tRNALeu depends on certain stress conditions (presence of H2O2), which causes selective translation of mRNA from genes enriched in the TTG codon.

Protein sequence:

MARRKNFKKGNKKTFGARDDSRAQKNWSELVKENEKWEKYYKTLALFPEDQWEEFKKTCQAPLPLTFRITGSRKHAGEVLNLFKERHLPNLTNVEFEGEK
IKAPVELPWYPDHLAWQLDVPKTVIRKNEQFAKTQRFLVVENAVGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVA
NDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDGTMRKNVNVWKDWNTQAGLGLHAVQLNILNRGLHLLK
NNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNT
GGFFITVFEKVEDSTEAATEKLSSETPALESEGPQTKKIKVEEVQKKERLPRDANEEPFVFVDPQHEALKVCWDFYGIDNIFDRNTCLVRNATGEPTRVV
YTVCPALKDVIQANDDRLKIIYSGVKLFVSQRSDIECSWRIQSESLPIMKHHMKSNRIVEANLEMLKHLLIESFPNFDDIRSKNIDNDFVEKMTKLSSGC
AFIDVSRNDPAKENLFLPVWKGNKCINLMVCKEDTHELLYRIFGIDANAKATPSAEEKEKEKETTESPAETTTGTSTEAPSAAN

Enzymatic activities:

Reaction Substrate Type Position
C:m5C tRNA (t)   34
C:m5C tRNA (t)   40
C:m5C tRNA (t) Asn/GUU/prokaryotic cytosol 48
C:m5C tRNA (t) Cys/GCA/prokaryotic cytosol 48
C:m5C tRNA (t) Ile/IAU/prokaryotic cytosol 48
C:m5C tRNA (t) Ile/UAU/prokaryotic cytosol 48
C:m5C tRNA (t) Leu/UAG/prokaryotic cytosol 48
C:m5C tRNA (t) Leu/CAA/prokaryotic cytosol 48
C:m5C tRNA (t) Leu/UAA/prokaryotic cytosol 48
C:m5C tRNA (t) Lys/SUU/prokaryotic cytosol 48
C:m5C tRNA (t) Met/CAU/prokaryotic cytosol 48
C:m5C tRNA (t) Ser/CGA/prokaryotic cytosol 48
C:m5C tRNA (t) Ser/UGA/prokaryotic cytosol 48
C:m5C tRNA (t) Ser/IGA/prokaryotic cytosol 48
C:m5C tRNA (t) Thr/IGU/prokaryotic cytosol 48
C:m5C tRNA (t) Tyr/GUA/prokaryotic cytosol 48
C:m5C tRNA (t)   48
C:m5C tRNA (t) Arg/ICG/prokaryotic cytosol 49
C:m5C tRNA (t) Asp/GUC/prokaryotic cytosol 49
C:m5C tRNA (t) Glu/CUC/prokaryotic cytosol 49
C:m5C tRNA (t) Gly/GCC/prokaryotic cytosol 49
C:m5C tRNA (t) His/GUG/prokaryotic cytosol 49
C:m5C tRNA (t) Phe/GAA/prokaryotic cytosol 49
C:m5C tRNA (t) Val/UAC/prokaryotic cytosol 49
C:m5C tRNA (t) Val/CAC/prokaryotic cytosol 49
C:m5C tRNA (t) Val/IAC/prokaryotic cytosol 49
C:m5C tRNA (t)   49

Publications:

Title Authors Journal Details PubMed Id DOI
Multisite-specific tRNA:m5C-methyltransferase (Trm4) in yeast Saccharomyces cerevisiae: identification of the gene and substrate specificity of the enzyme. Motorin Y, Grosjean H RNA [details] 10445884 -
Reprogramming of tRNA modifications controls the oxidative stress response by codon-biased translation of proteins. Chan CT, Pang YL, Deng W, Babu IR, Dyavaiah M, Begley TJ, Dedon PC... Nat Commun [details] 22760636 -
Trm4 and Nsun2 RNA:mC Methyltransferases Form Metabolite-Dependent, Covalent Adducts with Previously Methylated RNA. Moon HJ, Redman KL... Biochemistry [details] 25375641 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca