Full name: Dimethyladenosine transferase 1, mitochondrial
Synonym: h-mtTFB, CGI75
GI: 315013580
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:936(None) - m6,6A
s:937(None) - m6,6A

Comments:



Protein sequence:

MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVY EVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKA FSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEV AERLAANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQ PFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHF KSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL

Publications:

Title Authors Journal Details PubMed Id DOI
Human mitochondrial transcription factor B1 methylates ribosomal RNA at a conserved stem-loop. Seidel-Rogol BL, McCulloch V, Shadel GS. Nat Genet. [details] 12496758 10.1038/ng1064
A human mitochondrial transcription factor is related to RNA adenine methyltransferases and binds S-adenosylmethionine. McCulloch V, Seidel-Rogol BL, Shadel GS. Mol Cell Biol. [details] 11809803 -
Methylation of 12S rRNA is necessary for in vivo stability of the small subunit of the mammalian mitochondrial ribosome. Metodiev MD, Lesko N, Park CB, Cámara Y, Shi Y, Wibom R, Hultenby K, Gustafsson CM, Larsson NG Cell Metab. [details] 19356719 10.1016/j.cmet.2009.03.001
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto