Modomics - A Database of RNA Modifications

Full name: rRNA methyltransferase 3, mitochondrial
Synonym: RNMTL1
GI: 962608793
Orf:
COG:
UniProt:
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:1370(2553) - Gm

Comments:



Protein sequence:

MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPG
DRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYP
KTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN
KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLF
EGKRQLRGRAEDLSRDRSYH

Publications:

Title Authors Journal Details PubMed Id DOI
Assignment of 2'-O-methyltransferases to Modification Sites on the Mammalian Mitochondrial Large Subunit 16S rRNA. Lee KW, Bogenhagen DF... J Biol Chem [details] 25074936 -
MRM2 and MRM3 are involved in biogenesis of the large subunit of the mitochondrial ribosome. Rorbach J, Boesch P, Gammage PA, Nicholls TJ, Pearce SF, Patel D, Hauser A, Perocchi F, Minczuk M Mol Biol Cell [details] 25009282 10.1091/mbc.E14-01-0014

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca